Design 4 New WordPress Websites + Migrate 2 Existing Sites (B2B, Multilingual, UX Focused)

@rajat07me

Hello, I will migrate your 5 WordPress sites into a Multisite network with full backup, no data loss, multilingual setup (EN/SC/TC), shared media, SEO plugin configuration, and deploy across DigitalOcean and Tencent Cloud with performance, CDN, and security optimization. Let’s connect now in chat to finalize and wrap.

@satec25

Hello, I have read the description of your project and understood that you are looking for Migrate 5 Multisite WordPress Sites. I am now ready to seamlessly migrate your 5 WordPress sites to a high-performance multisite network with full multilingual support, deploy them on DigitalOcean (Sydney) and Tencent Cloud (Hong Kong), and deliver a fully optimized and SEO-ready solution within 5-7 days. Please provide your root access and existing theme files so I can get started quickly.

@mascotindia123

Hi, I can take care of your complete setup including building 4 new WordPress sites, migrating the existing ones, and converting everything into a smooth multisite without any data loss. I’ll deliver everything cleanly with full documentation and keep the design consistent, fast, and easy to manage. ✅ I will first take a full backup of all sites, then move everything to a safe staging setup and convert it into multisite without any data loss. ✅ I recommend using tools like Duplicator and WPML/Polylang to handle migration and multilingual setup smoothly. ✅ I will deploy the sites on DigitalOcean and Tencent Cloud and set up CDN, caching, and security for better performance. ✅ It will take around 8–10 days to complete everything including setup, testing, and final delivery. Are you free to have a quick talk so that we can begin right away? With Gratitude and Best Wishes, Harpreet Singh

@r4rony

Hi, I can design, migrate, and deploy your 4 new WordPress sites + migrate 2 existing sites into a Multisite network across DigitalOcean (Sydney) and Tencent Cloud (Hong Kong) with full multilingual support (English, Simplified & Traditional Chinese). Approach: Full backup + safe migration (no data loss) WordPress Multisite setup with domain/region mapping WPML/Polylang multilingual configuration + language switcher SEO setup (Rank Math/Yoast with hreflang support) Performance optimization (CDN, caching, security hardening) GitHub/GitLab repo for code, DB, and media Deliverables: Fully working Multisite on both clouds 3-language frontend per site SEO + performance configured Full documentation (DNS, backups, deployment) We can communicate more on this matter. Kindly accept the offer so we can discuss further. Thank you Jennifer

@creatvmind

Hi Greetings! i can do your 4 New WordPress Websites and do migrations also.. i read your project description carefully. please send me all requirement.. will do with interactive and modern look. 1) i will create a Mockup design using your site requirement like - Site name or Logo, colors, sample site links for structure 2) Wen you finalize design i will do website nicely using selected design so you can edit all contents from admin easily .. i have 16 years of experience and done 100's of websites which are running successfully.. can you please get back to me to start the work .. thanks for your time Lalith

@a4logic

Hello, Drawing from my extensive experience at Our Software, I assure you that I am more than capable of delivering on the demands of your project. Having worked on web design & development initiatives for over a decade, we specialize in creating websites with a "WOW" factor. The fact that no project is too big or small for us resonates deeply with this endeavor given its complexity and scale. The skills essential to translating the intricate details of your current multilingual multisite portfolio sites into a central Multisite network are right up our alley. What's more, we consistently work with clients who prioritize optimal function for SEO, high performance and security, areas where we'll come bearing the most effective plugins, CDN recommendations, and more. Our proficiency in HTML and PHP together with our vast knowledge in WordPress allows us to handle whatever tool you prefer providing an efficient migration without compromising data. Another element that sets us apart is our unwavering commitment to ensuring client satisfaction, even after delivery. We invest quality time crafting user-friendly handover documentation. This will not only guide you through DNS management and backups but also specify all the necessary steps for future deployments-a crucial aspect especially across different regions like Hong Kong and Sydney. Let's turn your vision into a reality - mirroring its "WOW" essence across both clouds! Let's get started right away! Thanks!

@logintobusiness

Hi, I am a skilled WordPress developer, and I can migrate your 5 live WordPress sites into a single Multisite network while ensuring zero data loss through full backups and safe migration. I will deploy the multisite on both DigitalOcean (Sydney) and Tencent Cloud (Hong Kong), configure site-to-region mapping, and implement flawless multilingual support (English, Simplified Chinese, Traditional Chinese) with proper language switching and locale setup. I will also integrate and configure an SEO plugin like Rank Math or Yoast for multilingual SEO, ensure performance and security optimization, and set up Git-based source control for code, database, and media. Full documentation for DNS, backups, and deployment will be provided. Please send a message so we can go through the details, decide on the timeline and deliverables. Best regards.

@ykarora26

Hello there, I am excited about the opportunity to work on your project involving the rebuilding of five live WordPress sites into a WordPress Multisite network, to be deployed across DigitalOcean’s Sydney data-centre and Tencent Cloud in Hong Kong. Ensuring flawless language-switching and shared media libraries in English, Simplified Chinese, and Traditional Chinese is essential, along with maintaining design consistency and responsiveness across the network. I am committed to implementing industry-standard SEO practices and welcome any additional suggestions to enhance performance, security, and CDN integration within the two-cloud architecture. My approach includes full backup, migration, theme customization, and configuring essential plugins for optimal multilingual SEO. I look forward to delivering a seamless and high-quality solution for your portfolio showcase sites. Regards, Yogesh Kumar

@bhaveshjnariya

Hi, I am Preferred freelancer and WordPress developer with 12 years of experience in Web development, Website design, WooCommerce development and API integration. I have successfully worked on a variety of projects and have a proven track record of delivering high-quality, responsive, and user-friendly websites. I can assist you with: - Figma to Website - WordPress optimization - WooCommerce/eCommerce web development - Elementor design and development - Website design - Business/Informational Website - Developing WordPress/WooCommerce site from the ground up - API Integration - Website support & maintenance - Custom theme & plugin development or customization Kindly review my clients feedbacks and portfolio at https://www.freelancer.com/u/bhaveshjnariya Let's connect and discuss to start right away! Best regards, Bhavesh

@webperfection123

Hi, I can manage migrating your five WordPress sites into a Multisite setup while ensuring no data loss. I recommend starting with a full backup, then setting up the Multisite environment to maintain design consistency across all languages. I’ll use an SEO plugin like Yoast to enhance your site’s visibility and configure it for multilingual use. I’ll also implement suggestions for performance and security tailored for DigitalOcean and Tencent Cloud. Once we agree on the approach, I’ll provide comprehensive handover documentation covering everything from DNS to deployment steps. I have over 9+ years of experience with WordPress Multisite configurations and deployments. Looking forward to discussing this with you! Best Regards, Priyanka

@ranjika08

I can migrate your five WordPress sites into a single Multisite network with full backups and zero data loss, then deploy it across DigitalOcean and Tencent Cloud with proper site-to-region mapping. I’ll set up smooth multilingual support, shared media, and configure SEO for all languages. I’ll also recommend a lightweight, consistent design and handle Git-based storage, performance, and security, along with clear documentation for ongoing management. Best regards, Ranjika.

@techplusintl

Hi, To rebuild your five WordPress sites into a Multisite network, I'll ensure a seamless migration and setup across both cloud environments. This will include: - Full backup of existing installs before migration. - Conversion to Multisite with no data loss. - Implementation of a multilingual setup with language switching. - Configuration of an SEO plugin for all languages. - Documentation for DNS, backups, and deployment steps. I will handle the migration using a structured approach, utilizing tools like WP-CLI for efficiency and ensuring that the design remains consistent and responsive across all sites. Ready to start once you provide root access and existing theme files. Thanks!

@diektech

Hi, This is Elias from Miami. I checked your project description and understand you’re looking to rebuild five live WordPress sites into a single WordPress Multisite network. This will streamline management and enhance functionality. I’ve worked on several similar platforms and understand the key technical challenges involved. My approach will include assessing the current sites, ensuring a smooth migration of content, and optimizing for SEO throughout the process. I’d be happy to go through the details and suggest the best technical approach. I have a few questions to get a better understanding: Q1 – What specific features or plugins are currently being used on the existing sites that need to be migrated? Q2 – Are there any particular integrations with other systems that we should consider during the migration? Q3 – What is your timeline for completing this project, and do you have any specific milestones in mind? Looking forward to hearing from you.

@marjanahmed13

Hi! My name is Marjan and I'm here to offer you my services as a skilled applicant with over a decade of experience working on Freelancer.com. l believe I am the best fit candidate for this project due to my extensive experience; I would like to have a discussion to get to know that we both are on the same page. Once the scope will be locked, I will start working on it right away.

@kamran2012

Hello, I will migrate your five WordPress sites into a single Multisite network, deploy it across DigitalOcean Sydney and Tencent Cloud Hong Kong, and configure trilingual front ends with proper hreflang tags and locale metadata for each site. For the two-cloud setup, I will use a Git-based deployment pipeline from your GitLab/GitHub repo with database replication between regions — so content updates propagate automatically without manual syncing. I will configure Rank Math with per-language sitemaps and implement object caching with Redis to keep page loads fast across both nodes. Questions: 1) Are the three language versions already translated, or do you need WPML/Polylang to manage translations going forward? 2) Should each cloud serve specific regions via geo-DNS, or will one act as a failover for the other? Looking forward to your response. Best regards, Kamran

@AliAsif4856

Hello, I can migrate your 5 WordPress sites into a single Multisite network and deploy it across DigitalOcean (Sydney) and Tencent Cloud (Hong Kong) with full multilingual support. Approach Full backups of all sites (files + DB) before any changes Convert to Multisite and migrate each site without data loss Configure shared media and consistent theme across the network Multilingual Setup Implement WPML or Polylang (based on best fit) Configure English, Simplified Chinese, Traditional Chinese Clean language switching + correct locale/meta setup Deployment (Two Clouds) Set up environments on both providers Configure site-to-region mapping + DNS routing Ensure performance and sync strategy between regions SEO & Performance Install and configure Rank Math or Yoast for multilingual SEO Optimize structure, sitemaps, and indexing per language Add caching/CDN strategy suited for dual-region delivery Tools WP-CLI, Git (GitHub/GitLab), SSH-based migration, rsync Deliverables Fully working Multisite on both clouds All sites translated with proper switching SEO plugin configured across network Clear handover (DNS, deployment, backups) Ready to start once access is shared. Ali Asif

@vashishtrupinder

Hello, Thanks for the detailed requirements. I can start immediately. I’ll begin with full backups of all 5 live sites, including files and databases, ensuring zero data loss. Next, I’ll convert everything into a secure WordPress Multisite network with a shared media library and consistent lightweight theme across all sites. I’ll configure multilingual support using WPML for English, Simplified Chinese, and Traditional Chinese with correct hreflang SEO structure. For search optimization, I’ll implement Rank Math. Finally, I’ll deploy across DigitalOcean Sydney and Tencent Cloud Hong Kong with Git-based version control, documentation, and full handover support. I can begin right away. thank you Azad

@Hammadhassan21

Hey, I understand that rebuilding five live WordPress websites into a single multisite network while keeping full data safety multilingual functionality and stable deployment across two cloud platforms is a complex and high risk task where even a small mistake can cause data loss downtime or SEO impact. I will start with a complete backup of all existing websites and carefully rebuild them into a clean WordPress multisite architecture without any data loss. I will configure site mapping for both DigitalOcean Sydney and Tencent Cloud Hong Kong and ensure proper deployment strategy across both environments. I will implement full multilingual support for English Simplified Chinese and Traditional Chinese with seamless language switching correct locale handling and shared media library across all sites. Here you can check my portfolio httpswwwfreelancerpkfhammadhassan21 I believe in clear communication and I will provide regular updates at every stage including backup migration testing and deployment so you can fully validate progress before moving forward. I will also provide complete documentation covering DNS setup backups deployment steps and ongoing maintenance guidance so your team can manage the system easily after handover. Please start a chat so we can discuss a few important questions and I am ready to start immediately Thanks...

@doomshellsl

Hi, Doomshell Software can handle your WordPress Multisite migration and dual-cloud deployment with a focus on stability, multilingual SEO, and performance. Our approach: We begin with full backups of all five sites, then migrate them into a single Multisite network using a staging setup to ensure zero data loss. Each site will be preserved and standardized under a consistent, lightweight design system. Multilingual setup: • Implement EN / Simplified Chinese / Traditional Chinese across all sites • Seamless language switcher with correct locale + hreflang tags • Shared media library across the network Deployment (Dual Cloud): • Configure Multisite on DigitalOcean (Sydney) and Tencent Cloud (Hong Kong) • CDN + caching strategy for fast global delivery SEO & performance: • Setup Rank Math or Yoast with multilingual configuration • Optimize meta, sitemap, and indexing per language • Security hardening + performance tuning Version control: All code, database structure, and media handled via GitHub/GitLab workflows for clean deployment and future scalability. Deliverables: • Fully functional Multisite on both clouds • 3-language frontends per site • Configured SEO + performance stack • Clear handover documentation (DNS, backups, deployment) Quick questions: Do you prefer subdomain or subdirectory structure for Multisite? Any preferred translation workflow (manual vs plugin-assisted)? Ready to deliver a scalable, multilingual, high-performance setup. Best Regards,