
Closed
Posted
Paid on delivery
I'm seeking a skilled developer to create a comprehensive e-commerce website for selling workwear, with the option of embroidery and/or DTF Key Requirements: - E-commerce functionality to support a wide range of products - Integration of credit/debit card payment options - Optional user account functionality for purchases Ideal Skills and Experience: - Proven experience in developing secure e-commerce websites - Expertise in payment gateway integration, specifically with credit/debit cards - Familiarity with user account management features in e-commerce platforms Please provide examples of similar work done. Looking forward to your bids!
Project ID: 40364562
309 proposals
Remote project
Active 23 secs ago
Set your budget and timeframe
Get paid for your work
Outline your proposal
It's free to sign up and bid on jobs
309 freelancers are bidding on average £1,044 GBP for this job

Hello. You need a scalable e-commerce site for workwear with embroidery/DTF options and secure payments. I’ll build a clean Shopify/WordPress store with product customization logic and optimized checkout for higher conversions. This ensures seamless ordering and repeat purchases. Will customization (embroidery/DTF) affect pricing dynamically per product variant or via add-ons? Let's discuss in chat as I have some queries to ask regarding the project to proceed further.
£750 GBP in 7 days
9.8
9.8

Hi, I am interested in Wotkwear E-commerce website setup project. I can help you with everything you're looking for. With over 10+ years of experience, I am committed to delivering high-quality work on time. I will share samples via private chat. I look forward to collaborating with you. Thanks Tretanz
£750 GBP in 10 days
9.7
9.7

Hello, Good Day! I’m excited about the opportunity to build your workwear e-commerce website with customization options like embroidery and DTF. This is a great use case for a scalable and user-friendly online store, and I can help you deliver a professional platform that supports both product sales and custom order workflows. With strong experience in e-commerce development, I can build a system that supports a wide product catalog, customization options (such as selecting embroidery/DTF during checkout), secure credit/debit card payments (Stripe or similar), and optional user accounts for order tracking and repeat purchases. I’ll ensure the site is mobile-responsive, fast, and designed for conversions, while keeping the backend easy to manage. I’ve developed similar e-commerce platforms with product variations, customization flows, and payment integrations, ensuring both reliability and a smooth user experience. At Imara Software Solutions, we focus on building clean, scalable systems that can grow with your business. I’d be happy to discuss the best platform (Shopify, WooCommerce, or custom) based on your goals and get started. Kind Regards, Rinsad
£750 GBP in 7 days
9.8
9.8

Hello! I reviewed your project and I can help build a professional e-commerce website tailored for selling workwear with embroidery/DTF customization options. I have experience developing secure e-commerce stores with product customization, payment integrations, and scalable catalog structures. Approach: Build a modern, responsive online store with support for large product ranges Add embroidery / DTF customization options per product Integrate secure credit/debit card payments (Stripe/PayPal/etc.) Implement optional customer accounts for faster repeat purchases Optimize checkout flow for conversions and mobile usability Recommended Stack: Shopify / WooCommerce depending on your flexibility and future scaling needs I focus on building stores that are clean, secure, conversion-focused, and easy to manage. Happy to share relevant e-commerce examples and discuss the best platform for your needs. Best regards, Jasmin
£1,125 GBP in 7 days
9.4
9.4

With over a decade of experience in full-stack architecture and high-scale systems, I understand your goal of developing a comprehensive e-commerce website for selling workwear, complete with customization options such as embroidery and DTF. My background in scaling projects for 1M+ users and expertise in high-security FinTech directly align with the complexities of your project. For strategic insight, I recommend implementing a robust user account management system to enhance customer retention and streamline future purchases. Drawing from my experience in developing secure e-commerce websites, I am confident in delivering a solution that meets your requirements with seamless credit/debit card payment integration. Having successfully integrated payment gateways and user account functionalities in past projects, including high-security systems, I am well-equipped to handle the intricacies of your workwear e-commerce website. I look forward to discussing the roadmap with you further to ensure a successful partnership. Thank you for considering my bid.
£1,200 GBP in 20 days
9.1
9.1

⭐⭐⭐⭐⭐ Having successfully delivered numerous e-commerce projects, including those with customization options like embroidery, I am confident in executing your vision for a workwear website. My extensive experience in developing secure e-commerce platforms equipped me with the necessary skills to ensure smooth credit/debit card payments and efficient account management functionalities. I have a profound understanding of popular e-commerce technologies such as PHP, WordPress, and WooCommerce, making me adept at handling content management systems crucial for a robust workwear platform. Additionally, my proficiency in payment gateway integration guarantees a seamless transaction process for your customers. Ultimately, my dedication to providing top-quality solutions within agreed timelines and budgets has consistently earned the trust and satisfaction of my clients. By choosing CnELIndia for the task, you're not only selecting a higher level of expertise but also a trusted partner who will work tirelessly to bring your vision to fruition. Let's create a formidable online presence for your workwear brand together.
£1,125 GBP in 7 days
9.1
9.1

I have extensive experience in developing secure e-commerce websites with payment gateway integration and user account management features. I understand your need for a comprehensive workwear e-commerce website with embroidery and DTF options. I have worked on similar projects in the past and can assure you of a high-quality solution tailored to your requirements. Please review my profile for examples of my work over the last 15 years. Let's discuss the project details further to ensure we are on the same page. I am ready to start working on this project and demonstrate my dedication. Looking forward to hearing from you.
£750 GBP in 12 days
8.8
8.8

Hi I can build you a complete, secure, and scalable e-commerce website for your workwear business, including product management, smooth checkout, and full support for embroidery and DTF customization options. I have strong experience in developing WooCommerce/Shopify-based stores with reliable credit/debit card payment integrations (Stripe, PayPal, etc.), user account systems, and conversion-focused product layouts. I will ensure the site is fast, mobile-friendly, and easy for you to manage, with a clean structure that supports both standard products and custom embroidery/DTF options. I can also share relevant e-commerce examples in chat and recommend the best platform based on your budget and growth plans. My focus is always on secure checkout flow, strong UX, and long-term scalability. Thanks
£750 GBP in 1 day
8.2
8.2

Hello there, I am excited to offer my expertise as a skilled developer to create a comprehensive e-commerce website tailored for selling workwear, complete with optional embroidery and/or DTF services. I bring a proven track record in developing secure e-commerce platforms, with a focus on integrating credit/debit card payment options and user account functionalities for seamless purchases. I look forward to showcasing examples of my previous work in this domain and am eager to collaborate on this project. Thank you for considering my proposal. Regards, Yogesh Kumar
£1,170 GBP in 7 days
8.5
8.5

Hi, I am an experienced web developer, and I can build a secure and scalable e-commerce website for your workwear business with full product management, smooth checkout, and credit/debit card payment integration. I will also implement optional customer accounts, and structure the store to support embroidery and DTF customization options for products, ensuring a seamless shopping experience. Please send a message so we can go through the details, decide on the timeline and deliverables. Best regards.
£750 GBP in 7 days
8.5
8.5

Hello, Hope you are doing well, I understand you need a full-featured e-commerce website for selling workwear, including customization options like embroidery/DTF, secure card payments, and optional user accounts. I will build a scalable store (Shopify or WooCommerce) with product customization flows, secure payment integration, and a smooth shopping experience optimized for conversions. With 10+ years of experience in e-commerce development, I’ve delivered similar custom-product stores with payment gateways and user account systems. Let’s connect to discuss your product range and start building your store efficiently. thank you Regards Gaurav Garg
£750 GBP in 7 days
8.6
8.6

Hello there, I will build your workwear e-commerce store with a product customization flow for embroidery and DTF — covering catalog setup, payment processing, and optional customer accounts. For the embroidery/DTF options, I will set up a product-level customizer where buyers select decoration type, upload logos or text, and see pricing adjust in real time before adding to cart. Each customization choice will pass as structured line-item data to your order dashboard — so your production team knows exactly what to print or stitch without manual follow-up. Questions: 1) Do you have a platform preference — WooCommerce, Shopify, or open to recommendation? 2) How many product SKUs are you launching with, and will embroidery/DTF pricing vary by decoration size or placement? I am happy to share relevant examples in our chat. Looking forward to talking through the details. Kamran
£1,167 GBP in 25 days
8.5
8.5

Hi, This is Elias from Miami. I checked your project description and understand you need a full e-commerce website for selling workwear, with support for a broad product catalog and customization options like embroidery and DTF during the buying flow. I’d approach this by building a secure storefront with clear product setup, card payments, and a smooth customization/order process that stays easy for customers and manageable for you behind the scenes. I’ve worked on e-commerce builds with product options, payment integrations, and account features where clean checkout flow and reliable order handling were key. I’d be happy to review the product structure and suggest the best platform for long-term growth. I have a few questions to get a better understanding: Q1 – Do you want embroidery and DTF handled as selectable product options with extra pricing, or as a custom quote/upload flow per order? Q2 – Do you already have a preferred platform in mind such as Shopify, WooCommerce, or would you like my recommendation? Q3 – Should customer accounts be optional for faster guest checkout, or do you want account creation encouraged for repeat business and order history? Looking forward to hearing from you.
£1,125 GBP in 7 days
8.0
8.0

As a developer with extensive experience in eCommerce and website development, I am confident in my ability to create the perfect online platform for your workwear business. My skills in HTML, PHP, and Shopping Cart Integration, combined with my knack for design, make me the ideal fit for this project. Just take a look at my portfolio of previous work to see the quality I bring to each project. You can trust that I will deliver an e-commerce site that not only meets your needs but also exceeds your expectations. Another key strength of mine is my knowledge of payment gateway integration, particularly credit/debit cards. I understand the importance of a seamless and secure transaction process for any eCommerce site and can ensure your customers have a smooth experience throughout. Lastly, I'm not just here to create a website; I'm here to build a solution that will make running your business easier. From optional user account functionality to dynamic personalization features like embroidery or DTF, I'll develop the tools you need to provide an exceptional shopping experience for your customers. So hire me today and let's get started on creating the perfect workwear e-commerce platform together!
£750 GBP in 7 days
8.1
8.1

Hey, I understand that selling workwear with embroidery and DTF options can become complicated when the website is not built properly and customers struggle with customization choices and checkout which directly affects sales and order accuracy. I have strong experience in ecommerce development using PHP and Python along with building product based stores that include customization flows secure payments and clean user account systems. I focus on creating smooth buying experiences that increase conversions and reduce cart drop off. I will build a complete ecommerce website for your workwear business with product catalog secure card payment integration and optional customer accounts. I will also implement a structured system for embroidery and DTF options so customers can easily select customization before checkout. The site will be fast responsive and easy to manage with a clean backend for products pricing and orders. Here you can check my portfolio httpswwwfreelancerpkfhammadhassan21 I believe in clear communication and I will keep you updated throughout the development process while ensuring secure testing for payments and full functionality before launch. Please start a chat so we can discuss a few important questions and I am ready to start immediately. Thanks...
£900 GBP in 7 days
7.8
7.8

I can build a secure, scalable e-commerce website for your workwear brand with full support for product variations like embroidery and DTF options. I’ll set up smooth checkout with card payments, optional user accounts, and an easy-to-manage backend. The site will be clean, responsive, and built to handle a wide product range while keeping the buying process simple and reliable. Best regards, Ranjika.
£750 GBP in 7 days
7.9
7.9

Hello, I am a honest dedicated full time developer. I read your requirements carefully and understood very well about the project scope and start working accordingly in stages. I am having more then 11+ years of experienced in programming and i believe that i can start working step by step and achieve the project goal in short time frame. successfully implement this project from start-to-finish. Let's come together and create a platform that not only propels your business but also stands out prominently within the marketplace. Thanks
£1,125 GBP in 7 days
7.7
7.7

Hello I’m excited about your workwear ecommerace Website project and understand exactly what you’re aiming for and I’ll focus on solving that from day one ✨ ➤ WHAT I’LL DELIVER ✅ Tailored solution aligned precisely with your requirements ✅ Clean, modern & conversion-focused execution ✅ Fully responsive (mobile, tablet, desktop) ✅ Fast performance + SEO-ready structure ✅ Easy-to-manage setup with smooth workflow ✅ Free demo/sample based on your project title ✅ Unlimited revisions ✅ 100% money-back guarantee ➤ WHY ME ✅ Proven experience solving similar client pain points ✅ Strong focus on quality, usability & scalability ✅ Clear communication with regular updates ✅ Reliable delivery with long-term support mindset Let’s turn your idea into a powerful, results-driven solution ? Message me now and I’ll start with a free demo right away!
£750 GBP in 3 days
7.7
7.7

✅ E-Commerce Website | Workwear Store | Payment Integration Expert ✅ Hello, I have reviewed your requirements and I can help you build a clean, secure, and scalable e-commerce website for your workwear business with embroidery/DTF options. I’ve already worked on similar systems: E-commerce Platforms: Built full-featured online stores with product variations, filtering, and smooth checkout flows. Payment Integration: Implemented secure credit/debit card payments with reliable gateways. User Systems: Developed optional user accounts for order tracking and easy repeat purchases. How I’ll build your platform: ✔ Product catalog with variations (size, embroidery/DTF options) ✔ Secure payment gateway (cards + other options if needed) ✔ Optional user accounts (login, orders, profile) ✔ Fast, responsive design (mobile + desktop) ✔ Easy admin panel to manage products & orders Timeline: Week 1: Setup + design Week 2: Features + payment integration Week 3: Testing + launch I would really love to be a part of your project and help you build a strong online store. It would be great to work together and take this to a successful launch. Let’s connect and get started. Best Regards, Ashraf K
£1,500 GBP in 20 days
7.6
7.6

⭐⭐⭐⭐⭐ Create a Complete E-commerce Website for Workwear with Payment Integration ❇️ Hi My Friend, I hope you're doing well. I’ve reviewed your project requirements and see you are looking for a skilled developer to create an e-commerce website for workwear. You have no need to look any further; Zohaib is here to help you! My team has successfully completed 50+ similar projects for e-commerce websites. I will ensure a user-friendly experience, integrate secure payment options, and provide account management features all within your budget. ➡️ Why Me? I can easily build your e-commerce website as I have 5 years of experience in web development, focusing on e-commerce solutions, payment gateway integration, and user account management. Not only this, but I also have a strong grip on responsive design and security measures to keep your site safe. ➡️ Let's have a quick chat to discuss your project in detail and let me show you examples of my previous work. Looking forward to discussing with you in chat. ➡️ Skills & Experience: ✅ E-commerce Development ✅ Payment Gateway Integration ✅ User Account Management ✅ Responsive Design ✅ Security Implementation ✅ HTML/CSS/JavaScript ✅ PHP/MySQL ✅ Website Maintenance ✅ SEO Optimization ✅ UI/UX Design ✅ Troubleshooting ✅ Project Management Waiting for your response! Best Regards, Zohaib
£900 GBP in 2 days
7.8
7.8

Newport, United Kingdom
Member since Apr 11, 2026
₹12500-37500 INR
₹600-1500 INR
₹1500-12500 INR
₹1500-12500 INR
$2-8 USD / hour
$15-25 USD / hour
$250-750 CAD
$250-750 USD
$10-30 USD
₹1500-12500 INR
$10-30 USD
$12-30 SGD
$1500-3000 AUD
₹750-1250 INR / hour
$30-250 USD
€8-30 EUR
₹600-1500 INR
₹500 INR
$10-30 USD
$10-30 USD